
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHMP5 Antibody
상품 한눈에 보기
인간 CHMP5 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. 독립 항체 간 비교 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 제공. 토끼 유래 IgG 포맷으로 다양한 연구 응용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056437-100 Anti-CHMP5 Antibody, charged multivesicular body protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056437-25 Anti-CHMP5 Antibody, charged multivesicular body protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHMP5 Antibody
Anti-CHMP5 Antibody
Target: charged multivesicular body protein 5
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CHMP5
Alternative Gene Names
C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | charged multivesicular body protein 5 |
| Target Gene | CHMP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRV |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000008672 (99%), Mouse ENSMUSG00000028419 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



