CacheBy
Atlas Antibodies Anti-CHMP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHMP5 Antibody

상품 한눈에 보기

인간 CHMP5 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. 독립 항체 간 비교 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 제공. 토끼 유래 IgG 포맷으로 다양한 연구 응용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056437-100 Anti-CHMP5 Antibody, charged multivesicular body protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056437-25 Anti-CHMP5 Antibody, charged multivesicular body protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHMP5 Antibody

Anti-CHMP5 Antibody

Target: charged multivesicular body protein 5


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human CHMP5


Alternative Gene Names

C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60

Open Datasheet


Target Information

항목 내용
Target Protein charged multivesicular body protein 5
Target Gene CHMP5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRV
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008672 (99%), Mouse ENSMUSG00000028419 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.