CacheBy
Atlas Antibodies Anti-CHN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHN2 Antibody

상품 한눈에 보기

인간 CHN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. ARHGAP3(RhoGAP3) 대체 유전자명으로도 알려진 chimerin 2 단백질 검출에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019026-100 Anti-CHN2 Antibody, chimerin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019026-25 Anti-CHN2 Antibody, chimerin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHN2 Antibody

Anti-CHN2 Antibody

Target Information

  • Target Protein: chimerin 2
  • Target Gene: CHN2
  • Alternative Gene Names: ARHGAP3, RhoGAP3

이미지의 OCR 텍스트: IHC (Immunohistochemistry)

Product Description

Polyclonal Antibody against Human CHN2

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000009411 (100%)
    • Mouse ENSMUSG00000004633 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.