
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHMP4B Antibody
상품 한눈에 보기
Human CHMP4B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 실험에 적합하며 재조합 발현 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 인간, 마우스, 랫트에서 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051751-100 Anti-CHMP4B Antibody, charged multivesicular body protein 4B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051751-25 Anti-CHMP4B Antibody, charged multivesicular body protein 4B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHMP4B Antibody
Anti-CHMP4B Antibody
Target: charged multivesicular body protein 4B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against Human CHMP4B
Alternative Gene Names
C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | charged multivesicular body protein 4B |
| Target Gene | CHMP4B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000038467 (100%), Rat ENSRNOG00000046585 (100%) |
Antigen Sequence:SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



