CacheBy
Atlas Antibodies Anti-CHMP4B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHMP4B Antibody

상품 한눈에 보기

Human CHMP4B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 실험에 적합하며 재조합 발현 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 인간, 마우스, 랫트에서 반응 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051751-100 Anti-CHMP4B Antibody, charged multivesicular body protein 4B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051751-25 Anti-CHMP4B Antibody, charged multivesicular body protein 4B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHMP4B Antibody

Anti-CHMP4B Antibody

Target: charged multivesicular body protein 4B

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human CHMP4B

Alternative Gene Names

C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B

Open Datasheet

Target Information

항목 내용
Target Protein charged multivesicular body protein 4B
Target Gene CHMP4B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000038467 (100%), Rat ENSRNOG00000046585 (100%)

Antigen Sequence:
SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.