CacheBy
Atlas Antibodies Anti-CHCHD10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHCHD10 Antibody

상품 한눈에 보기

인간 CHCHD10 단백질에 대한 고품질 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 결과를 제공합니다. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제 방식 적용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003440-100 Anti-CHCHD10 Antibody, coiled-coil-helix-coiled-coil-helix domain containing 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003440-25 Anti-CHCHD10 Antibody, coiled-coil-helix-coiled-coil-helix domain containing 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHCHD10 Antibody

Anti-CHCHD10 Antibody

coiled-coil-helix-coiled-coil-helix domain containing 10


  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human CHCHD10


Alternative Gene Names

  • C22orf16
  • N27C7-4

Open Datasheet


Specifications

항목 내용
Target Protein coiled-coil-helix-coiled-coil-helix domain containing 10
Target Gene CHCHD10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000053231 (89%), Mouse ENSMUSG00000049422 (87%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.