
Atlas Antibodies Anti-CFAP52 Antibody
상품 한눈에 보기
휴먼 CFAP52 단백질을 인식하는 폴리클로날 항체로, 섬모 및 편모 관련 단백질 연구에 적합. IHC 및 오쏘고날 검증에 사용 가능. 토끼 유래 IgG 항체이며, 친화정제 방식으로 고순도 확보. RNA-seq 데이터 기반 단백질 발현 검증 지원.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CFAP52 Antibody
Target: cilia and flagella associated protein 52 (CFAP52)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CFAP52.
Alternative Gene Names
FLJ37528, WDR16, WDRPUH
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESH
Species Reactivity
- Verified Species: Human
- Interspecies Homology:
- Mouse (ENSMUSG00000020904): 90%
- Rat (ENSRNOG00000037718): 89%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CFAP57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CFAP53 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.