Atlas Antibodies Anti-CFAP52 Antibody

상품 한눈에 보기

휴먼 CFAP52 단백질을 인식하는 폴리클로날 항체로, 섬모 및 편모 관련 단백질 연구에 적합. IHC 및 오쏘고날 검증에 사용 가능. 토끼 유래 IgG 항체이며, 친화정제 방식으로 고순도 확보. RNA-seq 데이터 기반 단백질 발현 검증 지원.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023247-100 Anti-CFAP52 Antibody, cilia and flagella associated protein 52 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023247-25 Anti-CFAP52 Antibody, cilia and flagella associated protein 52 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cilia and flagella associated protein 52 (CFAP52)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human CFAP52.

FLJ37528, WDR16, WDRPUH

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESH

Verified Species: Human
Interspecies Homology:
- Mouse (ENSMUSG00000020904): 90%
- Rat (ENSRNOG00000037718): 89%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet