Atlas Antibodies Anti-CFAP54 Antibody
상품 한눈에 보기
Human CFAP54 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 제공. Affinity purification으로 높은 특이성과 재현성 확보. PBS/glycerol buffer에 보존 처리된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CFAP54 Antibody
Cilia and Flagella Associated 54 (CFAP54)
Polyclonal Antibody against Human CFAP54
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry): Suitable for ICC applications.
Product Description
Polyclonal antibody targeting the human CFAP54 protein.
Alternative Gene Names
C12orf55, C12orf63, FLJ31514, FLJ44112
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cilia and flagella associated 54 |
| Target Gene | CFAP54 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVA |
| Verified Species Reactivity | Human |
| Mouse Ortholog Identity | 78% (ENSMUSG00000020014) |
| Rat Ortholog Identity | 77% (ENSRNOG00000029837) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
- Open Datasheet (PDF)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-CFAP52 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CFAP53 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CFAP54 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CFAP47 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CFAP47 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.