Atlas Antibodies Anti-CFAP54 Antibody

상품 한눈에 보기

Human CFAP54 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 제공. Affinity purification으로 높은 특이성과 재현성 확보. PBS/glycerol buffer에 보존 처리된 고품질 항체.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039897-100 Anti-CFAP54 Antibody, cilia and flagella associated 54 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039897-25 Anti-CFAP54 Antibody, cilia and flagella associated 54 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CFAP54 Antibody

Anti-CFAP54 Antibody

Cilia and Flagella Associated 54 (CFAP54)
Polyclonal Antibody against Human CFAP54

Recommended Applications

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry): Suitable for ICC applications.

Product Description

Polyclonal antibody targeting the human CFAP54 protein.

Alternative Gene Names

C12orf55, C12orf63, FLJ31514, FLJ44112

Target Information

항목	내용
Target Protein	Cilia and flagella associated 54
Target Gene	CFAP54
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVA
Verified Species Reactivity	Human
Mouse Ortholog Identity	78% (ENSMUSG00000020014)
Rat Ortholog Identity	77% (ENSRNOG00000029837)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)