Atlas Antibodies Anti-CEP112 Antibody
상품 한눈에 보기
인간 CEP112 단백질을 표적으로 하는 폴리클로날 항체로, 세포 중심체 단백질 연구에 적합함. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었고, 마우스·랫과 높은 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CEP112 Antibody
Target: Centrosomal protein 112kDa
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC)
Product Description
Polyclonal antibody against human CEP112.
Alternative Gene Names
- CCDC46
- MGC33887
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Centrosomal protein 112kDa |
| Target Gene | CEP112 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000020728 (82%) Rat ENSRNOG00000024557 (77%) |
Antigen Sequence
RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-CEP120 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CEP162 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CEP112 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CEP128 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CEP104 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.