
Atlas Antibodies Anti-CELF5 Antibody
상품 한눈에 보기
인간 CELF5 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 Orthogonal validation 데이터로 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CELF5 Antibody
CUGBP, Elav-like family member 5
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CELF5
Alternative Gene Names
BRUNOL5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CUGBP, Elav-like family member 5 |
| Target Gene | CELF5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000034818 | 90% |
| Rat | ENSRNOG00000004695 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CENPB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CENPA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CELF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CEMP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CELSR3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.