Atlas Antibodies Anti-CDV3 Antibody

상품 한눈에 보기

Human CDV3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Human, Mouse, Rat에 반응하며 PrEST 항원을 이용해 Affinity 정제됨. 고품질 검증과 안정적 보존용액으로 신뢰성 높은 실험 결과 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029763-100 Anti-CDV3 Antibody, CDV3 homolog (mouse) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029763-25 Anti-CDV3 Antibody, CDV3 homolog (mouse) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CDV3 Antibody

Anti-CDV3 Antibody

Target: CDV3 homolog (mouse)
Type: Polyclonal Antibody against Human CDV3
Host: Rabbit

Recommended Applications

IHC (Independent antibody validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against Human CDV3.

Alternative Gene Names

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	CDV3 homolog (mouse)
Target Gene	CDV3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPS

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

종	유전자 ID	항원 서열 동일성
Mouse	ENSMUSG00000032803	97%
Rat	ENSRNOG00000010186	95%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand