
Thermo Fisher Scientific PRELID2 Polyclonal Antibody, MaxPab
PRELID2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, 인간 시료에 반응하며 Western blot에 적합합니다. 액상 형태로 제공되며, PBS 버퍼에 보존제가 포함되지 않습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1:500–1:1,000
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | PRELID2 (NP_995318.1, 1–177 a.a) full-length human protein |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
MGVSVDVHQVYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQNVVPEILRKV SILKVPNIQLEEESWLNPRE RNMAIRSHCLTWTQYASMKEESVFRESMENPNWTEFIQRG RISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE
Target Information
PRELID2 (PRELI Domain Containing 2) is a protein-coding gene. Gene Ontology (GO) annotations related to this gene include phosphatidic acid transporter activity. An important paralog of this gene is PRELID3B.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific CNKSR3 Polyclonal Antibody, MaxPab
582,600원

Thermo Fisher Scientific
Thermo Fisher Scientific PPP1R2P3 Monoclonal Antibody (1H2)
570,400원

Thermo Fisher Scientific
Thermo Fisher Scientific PRELID2 Polyclonal Antibody, MaxPab
518,100원

Thermo Fisher Scientific
Thermo Fisher Scientific CNKSR3 Polyclonal Antibody, MaxPab
518,100원

Thermo Fisher Scientific
Thermo Fisher Scientific PPP1R2P3 Monoclonal Antibody (2G11)
518,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|