
원본
Thermo Fisher Scientific PRELID2 Polyclonal Antibody, MaxPab
상품 한눈에 보기
PRELID2 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, 인간 시료에 반응하며 Western blot에 적합합니다. 액상 형태로 제공되며, PBS 버퍼에 보존제가 포함되지 않습니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 11:35
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific H00153768-B01P PRELID2 Polyclonal Antibody, MaxPab 50 ug pk판매 단위 pk ·
재고 확인 필요
518,100원VAT 포함 569,910원
Thermo Fisher Scientific · Thermo Fisher Scientific PRELID2 Polyclonal Antibody, MaxPab
Applications
Western Blot (WB)
- Tested Dilution: 1:500–1:1,000
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | PRELID2 (NP_995318.1, 1–177 a.a) full-length human protein |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
MGVSVDVHQVYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQNVVPEILRKV SILKVPNIQLEEESWLNPRE RNMAIRSHCLTWTQYASMKEESVFRESMENPNWTEFIQRG RISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE
Target Information
PRELID2 (PRELI Domain Containing 2) is a protein-coding gene. Gene Ontology (GO) annotations related to this gene include phosphatidic acid transporter activity. An important paralog of this gene is PRELID3B.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
