
Atlas Antibodies Anti-CDKN2C Antibody
상품 한눈에 보기
Human CDKN2C 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성과 재현성 확보. INK4C(p18) 대체명으로 알려짐. Affinity purification 방식으로 정제된 고품질 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDKN2C Antibody
Target: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Type: Polyclonal Antibody against Human CDKN2C
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human CDKN2C, validated for use in IHC and WB. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- INK4C
- p18
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
| Target Gene | CDKN2C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000008956 (88%), Mouse ENSMUSG00000028551 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDON Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDKN2D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDKN2C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDKN2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDKN2AIPNL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.