
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDKN2C Antibody
상품 한눈에 보기
Human CDKN2C 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성과 재현성 확보. INK4C(p18) 대체명으로 알려짐. Affinity purification 방식으로 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019057-100 Anti-CDKN2C Antibody, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019057-25 Anti-CDKN2C Antibody, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDKN2C Antibody
Anti-CDKN2C Antibody
Target: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Type: Polyclonal Antibody against Human CDKN2C
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human CDKN2C, validated for use in IHC and WB. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- INK4C
- p18
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
| Target Gene | CDKN2C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000008956 (88%), Mouse ENSMUSG00000028551 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



