
Atlas Antibodies Anti-CDK7 Antibody
상품 한눈에 보기
Human CDK7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공하며, 인체 CDK7 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDK7 Antibody
Target: cyclin-dependent kinase 7 (CDK7)
Type: Polyclonal Antibody against Human CDK7
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 정교한 검증 수행
- WB (Orthogonal Validation): 고/저 발현 세포주에서 RNA-seq 데이터와 비교하여 단백질 발현 검증 수행
Product Description
Polyclonal antibody recognizing human CDK7 protein.
Validated for immunohistochemistry (IHC) and Western blot (WB).
Alternative Gene Names
CAK, CAK1, CDKN7, MO15, STK1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cyclin-dependent kinase 7 |
| Target Gene | CDK7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000018510 (92%)
- Mouse ENSMUSG00000069089 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDK9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.