CacheBy
Atlas Antibodies Anti-CDK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDK7 Antibody

상품 한눈에 보기

Human CDK7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공하며, 인체 CDK7 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007932-100 Anti-CDK7 Antibody, cyclin-dependent kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007932-25 Anti-CDK7 Antibody, cyclin-dependent kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDK7 Antibody

Anti-CDK7 Antibody

Target: cyclin-dependent kinase 7 (CDK7)
Type: Polyclonal Antibody against Human CDK7


  • IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 정교한 검증 수행
  • WB (Orthogonal Validation): 고/저 발현 세포주에서 RNA-seq 데이터와 비교하여 단백질 발현 검증 수행

Product Description

Polyclonal antibody recognizing human CDK7 protein.
Validated for immunohistochemistry (IHC) and Western blot (WB).


Alternative Gene Names

CAK, CAK1, CDKN7, MO15, STK1


Target Information

항목 내용
Target Protein cyclin-dependent kinase 7
Target Gene CDK7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018510 (92%)
  • Mouse ENSMUSG00000069089 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.