
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDK5RAP3 Antibody
상품 한눈에 보기
Human CDK5RAP3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. siRNA knockdown으로 유전적 검증 완료. 높은 종간 보존성(인간, 마우스, 랫드) 보유. Affinity purification으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022141-100 Anti-CDK5RAP3 Antibody, CDK5 regulatory subunit associated protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022141-25 Anti-CDK5RAP3 Antibody, CDK5 regulatory subunit associated protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDK5RAP3 Antibody
Anti-CDK5RAP3 Antibody
CDK5 regulatory subunit associated protein 3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, genetic validation by siRNA knockdown)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CDK5RAP3
Alternative Gene Names
C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CDK5 regulatory subunit associated protein 3 |
| Target Gene | CDK5RAP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000018669 (94%)
- Rat ENSRNOG00000048747 (90%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



