Atlas Antibodies Anti-CDK5RAP3 Antibody

상품 한눈에 보기

Human CDK5RAP3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. siRNA knockdown으로 유전적 검증 완료. 높은 종간 보존성(인간, 마우스, 랫드) 보유. Affinity purification으로 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022141-100 Anti-CDK5RAP3 Antibody, CDK5 regulatory subunit associated protein 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022141-25 Anti-CDK5RAP3 Antibody, CDK5 regulatory subunit associated protein 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CDK5RAP3 Antibody

Anti-CDK5RAP3 Antibody

CDK5 regulatory subunit associated protein 3

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, genetic validation by siRNA knockdown)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CDK5RAP3

Alternative Gene Names

C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114

Open Datasheet

Target Information

항목	내용
Target Protein	CDK5 regulatory subunit associated protein 3
Target Gene	CDK5RAP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000018669 (94%)
Rat ENSRNOG00000048747 (90%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)