
Atlas Antibodies Anti-CDK5RAP3 Antibody
상품 한눈에 보기
Human CDK5RAP3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. siRNA knockdown으로 유전적 검증 완료. 높은 종간 보존성(인간, 마우스, 랫드) 보유. Affinity purification으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDK5RAP3 Antibody
CDK5 regulatory subunit associated protein 3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, genetic validation by siRNA knockdown)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CDK5RAP3
Alternative Gene Names
C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CDK5 regulatory subunit associated protein 3 |
| Target Gene | CDK5RAP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000018669 (94%)
- Rat ENSRNOG00000048747 (90%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK5RAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDK4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.