Atlas Antibodies Anti-CDCA8 Antibody

상품 한눈에 보기

Human CDCA8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. 정제된 PrEST 항원을 이용한 친화 정제 방식. RNA-seq 기반 직교 검증 및 재조합 발현 검증 완료. 다양한 조직에서 CDCA8 발현 연구에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028120-100 Anti-CDCA8 Antibody, cell division cycle associated 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028120-25 Anti-CDCA8 Antibody, cell division cycle associated 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cell division cycle associated 8 (CDCA8)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of high and low expression tissues.
WB (Recombinant expression): Validation using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human CDCA8.

BOR, DasraB, FLJ12042, MESRGP

항목	내용
Target Protein	cell division cycle associated 8
Target Gene	CDCA8
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Verified Species Reactivity	Human
Interspecies Identity	Rat (66%), Mouse (64%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.