Atlas Antibodies Anti-CDCA7 Antibody

상품 한눈에 보기

Human CDCA7 단백질을 인식하는 토끼 폴리클로날 항체로, 세포주기 관련 연구에 적합함. PrEST 항원을 이용해 친화 정제되었으며, ICC 등 다양한 응용에 사용 가능. 인간에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005565-100 Anti-CDCA7 Antibody, cell division cycle associated 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005565-25 Anti-CDCA7 Antibody, cell division cycle associated 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Cell Division Cycle Associated 7 (CDCA7)
Supplier: Atlas Antibodies

Polyclonal antibody against human CDCA7 protein. Suitable for various research applications related to cell division and proliferation.

항목	내용
Target Protein	Cell Division Cycle Associated 7
Target Gene	CDCA7
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM
Verified Species Reactivity	Human
Interspecies Information	Mouse (38% identity), Rat (34% identity)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand