AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CDCA8 Antibody
상품 한눈에 보기
Human CDCA8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 재현성을 보장합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제된 고품질 연구용 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028783-100 Anti-CDCA8 Antibody, cell division cycle associated 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028783-25 Anti-CDCA8 Antibody, cell division cycle associated 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CDCA8 Antibody
Anti-CDCA8 Antibody
Target: Cell Division Cycle Associated 8 (CDCA8)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against human CDCA8.
Alternative Gene Names
BOR, DasraB, FLJ12042, MESRGP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cell Division Cycle Associated 8 |
| Target Gene | CDCA8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (66%), Mouse (64%) |
Antigen Sequence:
PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.