CacheBy
Atlas Antibodies Anti-CDCA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDCA2 Antibody

상품 한눈에 보기

Human CDCA2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, IgG 아이소타입입니다. Human에 반응하며, 보존용액으로 40% 글리세롤과 PBS를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030049-100 Anti-CDCA2 Antibody, cell division cycle associated 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030049-25 Anti-CDCA2 Antibody, cell division cycle associated 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDCA2 Antibody

Anti-CDCA2 Antibody

Target: cell division cycle associated 2 (CDCA2)
Type: Polyclonal Antibody against Human CDCA2

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Alternative Gene Names

  • PPP1R81
  • Repo-Man

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000048922): 40% identity
    • Rat (ENSRNOG00000025302): 40% identity

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.