
Atlas Antibodies Anti-CDCA3 Antibody
상품 한눈에 보기
인간 CDCA3 단백질을 인식하는 폴리클로날 항체로, 웨스턴블롯 검증 완료. 재조합 발현 검증 기반의 높은 특이성과 재현성 제공. 토끼 유래 IgG 항체로, 친화정제 방식으로 제조. 세포주기 관련 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDCA3 Antibody
Target: cell division cycle associated 3 (CDCA3)
Supplier: Atlas Antibodies
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human CDCA3.
Alternative Gene Names
GRCC8, TOME-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cell division cycle associated 3 |
| Target Gene | CDCA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000015529 (80%)
- Mouse ENSMUSG00000023505 (78%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDCA4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDCA4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDCA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDCA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC73 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.