CacheBy
Atlas Antibodies Anti-CDCA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDCA3 Antibody

상품 한눈에 보기

인간 CDCA3 단백질을 인식하는 폴리클로날 항체로, 웨스턴블롯 검증 완료. 재조합 발현 검증 기반의 높은 특이성과 재현성 제공. 토끼 유래 IgG 항체로, 친화정제 방식으로 제조. 세포주기 관련 단백질 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026587-100 Anti-CDCA3 Antibody, cell division cycle associated 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026587-25 Anti-CDCA3 Antibody, cell division cycle associated 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDCA3 Antibody

Anti-CDCA3 Antibody

Target: cell division cycle associated 3 (CDCA3)
Supplier: Atlas Antibodies


Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human CDCA3.


Alternative Gene Names

GRCC8, TOME-1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cell division cycle associated 3
Target Gene CDCA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000015529 (80%)
  • Mouse ENSMUSG00000023505 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application: WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.