Atlas Antibodies Anti-CDCA3 Antibody

상품 한눈에 보기

인간 CDCA3 단백질을 인식하는 폴리클로날 항체로, 웨스턴블롯 검증 완료. 재조합 발현 검증 기반의 높은 특이성과 재현성 제공. 토끼 유래 IgG 항체로, 친화정제 방식으로 제조. 세포주기 관련 단백질 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026587-100 Anti-CDCA3 Antibody, cell division cycle associated 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026587-25 Anti-CDCA3 Antibody, cell division cycle associated 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cell division cycle associated 3 (CDCA3)
Supplier: Atlas Antibodies

Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against Human CDCA3.

GRCC8, TOME-1

항목	내용
Target Protein	cell division cycle associated 3
Target Gene	CDCA3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ

Highest antigen sequence identity to orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand