
Atlas Antibodies Anti-CDC42EP1 Antibody
상품 한눈에 보기
Human CDC42EP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 PrEST 항원으로 친화 정제됨. CDC42 effector protein 연구에 활용 가능. Human에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDC42EP1 Antibody
CDC42 effector protein (Rho GTPase binding) 1을 인식하는 폴리클로날 항체입니다.
Recommended Applications
- IHC (Immunohistochemistry)
- ICC (Immunocytochemistry)
Product Description
- Type: Polyclonal Antibody against Human CDC42EP1
- Alternative Gene Names: Borg5, CEP1, MSE55
- Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CDC42 effector protein (Rho GTPase binding) 1 |
| Target Gene | CDC42EP1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치도 |
|---|---|---|
| Mouse | ENSMUSG00000049521 | 61% |
| Rat | ENSRNOG00000008517 | 54% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide preservative
- Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDC42EP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42EP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42EP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42EP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42BPG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.