Atlas Antibodies Anti-CDC37 Antibody
Human CDC37 단백질을 인식하는 고품질 polyclonal rabbit IgG 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 세포 분열 관련 단백질 연구에 최적화된 제품입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-CDC37 Antibody
Anti-CDC37 Antibody
Target Protein: Cell Division Cycle 37 (CDC37)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CDC37. Designed for detection and analysis of CDC37 protein involved in cell division regulation.
Alternative Gene Names
- P50CDC37
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cell Division Cycle 37 |
| Target Gene | CDC37 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (95%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERV
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.