
Atlas Antibodies Anti-CDC42BPA Antibody
상품 한눈에 보기
Human CDC42BPA 단백질에 특이적인 폴리클로날 항체입니다. Rabbit에서 제조되었으며 IgG 아이소타입입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human, Rat, Mouse 종에서 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDC42BPA Antibody
CDC42 binding protein kinase alpha (DMPK-like)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CDC42BPA.
Alternative Gene Names
FLJ23347, KIAA0451, MRCK, MRCKA, PK428
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CDC42 binding protein kinase alpha (DMPK-like) |
| Target Gene | CDC42BPA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000002841 (90%)
- Mouse ENSMUSG00000026490 (90%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDC42BPB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC42BPA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC34 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC40 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.