Atlas Antibodies Anti-CDC25B Antibody

상품 한눈에 보기

Human CDC25B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제됨. RNA-seq 데이터 기반 정교한 직교 검증 수행. 40% 글리세롤 PBS 버퍼에 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038892-100 Anti-CDC25B Antibody, cell division cycle 25B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038892-25 Anti-CDC25B Antibody, cell division cycle 25B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CDC25B Antibody

Anti-CDC25B Antibody

Target: cell division cycle 25B (CDC25B)
Type: Polyclonal Antibody against Human CDC25B
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Product Description

Polyclonal antibody raised in rabbit against human CDC25B.
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
PVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPDRK

Verified Species Reactivity

Species	Reactivity	Notes
Human	Verified	—

Interspecies Information

Ortholog	Gene ID	Sequence Identity
Rat	ENSRNOG00000021248	74%
Mouse	ENSMUSG00000027330	66%

Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Safety Information	Material Safety Data Sheet (MSDS)