
Atlas Antibodies Anti-CDC25B Antibody
상품 한눈에 보기
Human CDC25B 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제됨. RNA-seq 데이터 기반 정교한 직교 검증 수행. 40% 글리세롤 PBS 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CDC25B Antibody
Target: cell division cycle 25B (CDC25B)
Type: Polyclonal Antibody against Human CDC25B
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against human CDC25B.
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPDRK
Verified Species Reactivity
| Species | Reactivity | Notes |
|---|---|---|
| Human | Verified | — |
Interspecies Information
| Ortholog | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000021248 | 74% |
| Mouse | ENSMUSG00000027330 | 66% |
Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Safety Information | Material Safety Data Sheet (MSDS) |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CDC26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC25B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC25B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CDC20 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.