
Atlas Antibodies Anti-CCDC189 Antibody
상품 한눈에 보기
인간 CCDC189 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현), ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 보장. 인간에서 검증되었으며 설치류와 높은 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CCDC189 Antibody
Target: coiled-coil domain containing 189 (CCDC189)
Type: Polyclonal Antibody against Human CCDC189
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human CCDC189 protein.
Validated for multiple applications and recombinant expression systems.
Alternative Gene Names
C16orf93, MGC104706
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SCLPQFAFFPQPPLPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSL
Species Reactivity
- Verified: Human
- Interspecies Information:
- Rat ENSRNOG00000053015 (78%)
- Mouse ENSMUSG00000057176 (76%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage / Handling | Gently mix before use. Determine optimal concentrations and conditions experimentally. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CCDC190 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC190 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC189 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC188 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC186 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.