CacheBy
Atlas Antibodies Anti-CCDC181 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCDC181 Antibody

상품 한눈에 보기

Human CCDC181 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원을 이용한 Affinity 정제로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027312-100 Anti-CCDC181 Antibody, coiled-coil domain containing 181 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027312-25 Anti-CCDC181 Antibody, coiled-coil domain containing 181 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCDC181 Antibody

Anti-CCDC181 Antibody

Target: Coiled-coil domain containing 181 (CCDC181)
Type: Polyclonal Antibody against Human CCDC181
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody specifically targeting human CCDC181 protein.


Alternative Gene Names

  • C1orf114
  • FLJ25846

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTNGSCE


Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000026578 79%
Rat ENSRNOG00000002860 79%

Antibody Characteristics

Parameter Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.