
Atlas Antibodies Anti-CCDC181 Antibody
상품 한눈에 보기
Human CCDC181 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원을 이용한 Affinity 정제로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CCDC181 Antibody
Target: Coiled-coil domain containing 181 (CCDC181)
Type: Polyclonal Antibody against Human CCDC181
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody specifically targeting human CCDC181 protein.
Alternative Gene Names
- C1orf114
- FLJ25846
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCISNDFGQEDVLLSLTNGSCE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000026578 | 79% |
| Rat | ENSRNOG00000002860 | 79% |
Antibody Characteristics
| Parameter | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CCDC189 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC186 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC181 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC184 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCDC183 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.