Thermo Fisher Scientific FZD10 Polyclonal Antibody
FZD10 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 Immunocytochemistry에 사용 가능. Human에 반응하며, 액상 형태로 제공되고 PBS buffer에 2% sucrose 포함. -20°C 보관, 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FZD10 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1.0 µg/mL |
| Immunocytochemistry (ICC/IF) | 1:333 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Wet ice |
| RRID | AB_2688310 |
Product Specific Information
This target displays homology in the following species:
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%
Target Information
FZD10 (Frizzled-10) is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family.
It contains a signal peptide, a cysteine-rich domain in the N-terminal region, seven transmembrane domains, and a C-terminal PDZ domain-binding motif.
FZD10 is involved in signal transduction and intercellular transmission of polarity information during tissue morphogenesis, acting as a receptor for Wnt proteins.
It is highly expressed in placenta, fetal kidney, fetal lung, brain (cerebellum, cerebral cortex, medulla, spinal cord), and shows low expression in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung, and skeletal muscle.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.