
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CBLC Antibody
상품 한눈에 보기
Human CBLC 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 유비퀴틴 단백질 리가아제 연구용에 적합합니다. Human에 특이적으로 반응하며, PrEST 항원을 이용해 친화 정제되었습니다. ICC 등 다양한 응용에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035266-100 Anti-CBLC Antibody, Cbl proto-oncogene C, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035266-25 Anti-CBLC Antibody, Cbl proto-oncogene C, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CBLC Antibody
Anti-CBLC Antibody
Cbl proto-oncogene C, E3 ubiquitin protein ligase
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CBLC.
Alternative Gene Names
- CBL-3
- CBL-SL
- RNF57
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cbl proto-oncogene C, E3 ubiquitin protein ligase |
| Target Gene | CBLC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL |
Species Reactivity
- Verified: Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000018953 | 74% |
| Mouse | ENSMUSG00000040525 | 67% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



