
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAPZB Antibody
상품 한눈에 보기
인간 CAPZB 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조되었습니다. 인간, 마우스, 랫트에 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031531-100 Anti-CAPZB Antibody, capping protein (actin filament) muscle Z-line, beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031531-25 Anti-CAPZB Antibody, capping protein (actin filament) muscle Z-line, beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAPZB Antibody
Anti-CAPZB Antibody
Target: capping protein (actin filament) muscle Z-line, beta
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CAPZB.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Capping protein (actin filament) muscle Z-line, beta |
| Target Gene | CAPZB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000028745 (100%) Rat ENSRNOG00000007330 (100%) |
Antigen Sequence:
CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



