
Atlas Antibodies Anti-CAPZB Antibody
상품 한눈에 보기
인간 CAPZB 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조되었습니다. 인간, 마우스, 랫트에 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAPZB Antibody
Target: capping protein (actin filament) muscle Z-line, beta
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CAPZB.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Capping protein (actin filament) muscle Z-line, beta |
| Target Gene | CAPZB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000028745 (100%) Rat ENSRNOG00000007330 (100%) |
Antigen Sequence:
CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CARD19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARD19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPZB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARD10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARD11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.