CacheBy
Atlas Antibodies Anti-CAPZB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPZB Antibody

상품 한눈에 보기

인간 CAPZB 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조되었습니다. 인간, 마우스, 랫트에 반응성이 검증되었습니다. 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031531-100 Anti-CAPZB Antibody, capping protein (actin filament) muscle Z-line, beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031531-25 Anti-CAPZB Antibody, capping protein (actin filament) muscle Z-line, beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPZB Antibody

Anti-CAPZB Antibody

Target: capping protein (actin filament) muscle Z-line, beta
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CAPZB.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Capping protein (actin filament) muscle Z-line, beta
Target Gene CAPZB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000028745 (100%)
Rat ENSRNOG00000007330 (100%)

Antigen Sequence:
CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.