Atlas Antibodies Anti-C8orf88 Antibody

상품 한눈에 보기

Human C8orf88 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 반응성 확인 및 Rat, Mouse 유사성 정보 포함. 연구용 단백질 발현 분석에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA078486-100 Anti-C8orf88 Antibody, chromosome 8 open reading frame 88 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA078486-25 Anti-C8orf88 Antibody, chromosome 8 open reading frame 88 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C8orf88 Antibody

Anti-C8orf88 Antibody

Target: chromosome 8 open reading frame 88 (C8orf88)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human C8orf88.
Open Datasheet

Specifications

항목	내용
Target Protein	chromosome 8 open reading frame 88
Target Gene	C8orf88
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCK
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000047537 (92%), Mouse ENSMUSG00000050930 (29%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.