CacheBy
Atlas Antibodies Anti-C7orf26 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C7orf26 Antibody

상품 한눈에 보기

Human C7orf26 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 분석에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Human에 반응하며, glycerol/PBS buffer로 안정화되어 있습니다.

카탈로그번호
HPA042899-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042899-100 Anti-C7orf26 Antibody, chromosome 7 open reading frame 26 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042899-25 Anti-C7orf26 Antibody, chromosome 7 open reading frame 26 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C7orf26 Antibody

Anti-C7orf26 Antibody

Target: chromosome 7 open reading frame 26 (C7orf26)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C7orf26.


Alternative Gene Names

  • MGC2718

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 7 open reading frame 26
Target Gene C7orf26
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (52%)

Antigen Sequence:
AKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.