
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C6orf62 Antibody
상품 한눈에 보기
Human C6orf62 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인간, 생쥐, 랫트에 반응합니다. 고품질 단백질 발현 검증과 신뢰성 높은 연구용에 적합합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030566-100 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030566-25 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C6orf62 Antibody
Anti-C6orf62 Antibody
Target: chromosome 6 open reading frame 62 (C6orf62)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression.
- Recombinant expression validation (WB): Validation using target protein overexpression.
Product Description
Polyclonal antibody against human C6orf62.
Alternative Gene Names
DKFZP564G182, FLJ12619, XTP12
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
Verified Species Reactivity
- Human
Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Rat | ENSRNOG00000018456 | 100% |
| Mouse | ENSMUSG00000019132 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



