Atlas Antibodies Anti-C6orf62 Antibody

상품 한눈에 보기

Human C6orf62 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인간, 생쥐, 랫트에 반응합니다. 고품질 단백질 발현 검증과 신뢰성 높은 연구용에 적합합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030566-100 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030566-25 Anti-C6orf62 Antibody, chromosome 6 open reading frame 62 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C6orf62 Antibody

Anti-C6orf62 Antibody

Target: chromosome 6 open reading frame 62 (C6orf62)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression.
Recombinant expression validation (WB): Validation using target protein overexpression.

Product Description

Polyclonal antibody against human C6orf62.

Alternative Gene Names

DKFZP564G182, FLJ12619, XTP12

Open Datasheet

Antigen Information

Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)

Sequence:

NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS

Verified Species Reactivity

Human

Interspecies Information:
| Species | Gene ID | Sequence Identity |
|----------|----------|------------------|
| Rat | ENSRNOG00000018456 | 100% |
| Mouse | ENSMUSG00000019132 | 100% |

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)