CacheBy
Atlas Antibodies Anti-C7orf43 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C7orf43 Antibody

상품 한눈에 보기

Human C7orf43 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019359-100 Anti-C7orf43 Antibody, chromosome 7 open reading frame 43 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019359-25 Anti-C7orf43 Antibody, chromosome 7 open reading frame 43 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C7orf43 Antibody

Anti-C7orf43 Antibody

Target: chromosome 7 open reading frame 43 (C7orf43)
Type: Polyclonal Antibody against Human C7orf43


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C7orf43 protein.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ10925

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 7 open reading frame 43
Target Gene C7orf43
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000039214 (100%), Mouse ENSMUSG00000036948 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer and Storage


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.