CacheBy
Atlas Antibodies Anti-C7orf26 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C7orf26 Antibody

상품 한눈에 보기

인간 C7orf26 단백질을 인식하는 폴리클로날 항체. WB 및 ICC 응용에 적합하며, 토끼에서 생산된 IgG 형식. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 마우스와 랫과 유사성이 높음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052175-100 Anti-C7orf26 Antibody, chromosome 7 open reading frame 26 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052175-25 Anti-C7orf26 Antibody, chromosome 7 open reading frame 26 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C7orf26 Antibody

Anti-C7orf26 Antibody

Target: chromosome 7 open reading frame 26 (C7orf26)
Type: Polyclonal Antibody against Human C7orf26


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C7orf26 protein. Suitable for detection of chromosome 7 open reading frame 26.


Alternative Gene Names

  • MGC2718

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 7 open reading frame 26
Target Gene C7orf26
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSM

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000039244 96%
Rat ENSRNOG00000024567 52%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.