CacheBy
Atlas Antibodies Anti-C6orf1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C6orf1 Antibody

상품 한눈에 보기

인간 C6orf1 단백질을 인식하는 토끼 폴리클로날 항체로 다양한 연구용에 적합. LBH 등 대체 유전자명으로 알려짐. PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되어 신뢰성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037660-100 Anti-C6orf1 Antibody, chromosome 6 open reading frame 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037660-25 Anti-C6orf1 Antibody, chromosome 6 open reading frame 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C6orf1 Antibody

Anti-C6orf1 Antibody

Target: chromosome 6 open reading frame 1 (C6orf1)
Type: Polyclonal Antibody against Human C6orf1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against the human C6orf1 protein.


Alternative Gene Names

  • LBH
  • MGC57858

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 6 open reading frame 1
Target Gene C6orf1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000058039 (32%), Mouse ENSMUSG00000029580 (32%)

Antigen Sequence:

CWVLGLHFSLHPPSAASASHALTITSLPPGLLPFVGVELTAHPQALMGRGFPSGMGAAGRHLCFL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.