CacheBy
Atlas Antibodies Anti-C5orf63 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5orf63 Antibody

상품 한눈에 보기

Human C5orf63 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 기반 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA043240-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043240-100 Anti-C5orf63 Antibody, chromosome 5 open reading frame 63 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043240-25 Anti-C5orf63 Antibody, chromosome 5 open reading frame 63 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5orf63 Antibody

Anti-C5orf63 Antibody

Target: chromosome 5 open reading frame 63 (C5orf63)
Type: Polyclonal Antibody against Human C5orf63


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C5orf63.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ44606
  • YDR286C

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LPVLTLFTKDPCPLCDEAKEVLKPYENRFILQEVNITLPENSVWYERYKFDIPVFHLNGQFLMMHRVNTSK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024592 92%
Rat ENSRNOG00000013738 92%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentration and conditions experimentally.

Material Safety Data Sheet


제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.