CacheBy
Atlas Antibodies Anti-C5orf49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5orf49 Antibody

상품 한눈에 보기

Human C5orf49 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. RNA-seq 데이터 기반 정합 검증(Orthogonal validation) 적용. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043759-100 Anti-C5orf49 Antibody, chromosome 5 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043759-25 Anti-C5orf49 Antibody, chromosome 5 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5orf49 Antibody

Anti-C5orf49 Antibody

chromosome 5 open reading frame 49


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human C5orf49


Alternative Gene Names

  • LOC134121

Open Datasheet


Specifications

항목 내용
Target Protein chromosome 5 open reading frame 49
Target Gene C5orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000047406 (83%), Mouse ENSMUSG00000021534 (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

HRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPGFGHIAPS

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application - IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.