CacheBy
Atlas Antibodies Anti-C5orf51 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5orf51 Antibody

상품 한눈에 보기

인체 C5orf51 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 토끼 유래 IgG 형태로 높은 특이성과 순도를 제공. PrEST 항원으로 정제되어 재현성 높은 실험 결과를 지원.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043779-100 Anti-C5orf51 Antibody, chromosome 5 open reading frame 51 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043779-25 Anti-C5orf51 Antibody, chromosome 5 open reading frame 51 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5orf51 Antibody

Anti-C5orf51 Antibody

Target: chromosome 5 open reading frame 51
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C5orf51.

Alternative Gene Names

  • LOC285636

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 5 open reading frame 51
Target Gene C5orf51
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000041935 (83%) / Rat ENSRNOG00000050792 (23%)

Antigen Sequence:
IFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.