Atlas Antibodies Anti-C5AR1 Antibody

상품 한눈에 보기

인간 C5AR1 단백질을 인식하는 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체로, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014520-100 Anti-C5AR1 Antibody, complement component 5a receptor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014520-25 Anti-C5AR1 Antibody, complement component 5a receptor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human C5AR1.
Recommended for immunohistochemistry (IHC) and related applications.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as ligand
Recommended Applications	Immunohistochemistry (IHC)
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.