CacheBy
Atlas Antibodies Anti-C5AR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5AR1 Antibody

상품 한눈에 보기

인간 C5AR1 단백질을 인식하는 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체로, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014520-100 Anti-C5AR1 Antibody, complement component 5a receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014520-25 Anti-C5AR1 Antibody, complement component 5a receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5AR1 Antibody

Anti-C5AR1 Antibody

Target Information

  • Target Protein: Complement component 5a receptor 1
  • Target Gene: C5AR1
  • Alternative Gene Names: C5A, C5AR, C5R1, CD88

Product Description

Polyclonal antibody against human C5AR1.
Recommended for immunohistochemistry (IHC) and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000047800 (72%)
  • Mouse: ENSMUSG00000049130 (63%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as ligand
Recommended Applications Immunohistochemistry (IHC)
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.