Atlas Antibodies Anti-C5 Antibody

상품 한눈에 보기

Human C5 단백질을 인식하는 토끼 폴리클로날 항체로, 보체 성분 연구에 적합. IHC 등 다양한 응용에 사용 가능. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 사람에 대한 반응성이 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029339-100 Anti-C5 Antibody, complement component 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029339-25 Anti-C5 Antibody, complement component 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C5 Antibody

Anti-C5 Antibody

Target Information

Target Protein: Complement component 5
Target Gene: C5
Alternative Gene Names: C5a, C5b, CPAMD4

Product Description

Polyclonal antibody against human complement component 5 (C5).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat (ENSRNOG00000018899): 76%
Mouse (ENSMUSG00000026874): 74%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	IHC (Immunohistochemistry)
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions for each application.