AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C5AR1 Antibody
상품 한눈에 보기
Human C5AR1을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증되었으며, Rat 및 Mouse와도 높은 상동성을 가짐. 안정한 PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048012-100 Anti-C5AR1 Antibody, complement C5a receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048012-25 Anti-C5AR1 Antibody, complement C5a receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C5AR1 Antibody
Anti-C5AR1 Antibody
Target: Complement component 5a receptor 1 (C5AR1)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human C5AR1.
Alternative Gene Names
C5A, C5AR, C5R1, CD88
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Complement component 5a receptor 1 |
| Target Gene | C5AR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000047800 (72%), Mouse ENSMUSG00000049130 (63%) |
Antigen Sequence:
QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.