CacheBy
Atlas Antibodies Anti-C3orf14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C3orf14 Antibody

상품 한눈에 보기

인간 C3orf14 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 유사성을 보이며, PBS와 글리세롤 버퍼에 보존됩니다.

카탈로그번호
HPA048286-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048286-100 Anti-C3orf14 Antibody, chromosome 3 open reading frame 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048286-25 Anti-C3orf14 Antibody, chromosome 3 open reading frame 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C3orf14 Antibody

Anti-C3orf14 Antibody

Target: chromosome 3 open reading frame 14 (C3orf14)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C3orf14.


Alternative Gene Names

  • HT021

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 3 open reading frame 14
Target Gene C3orf14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000039871 (71%), Mouse ENSMUSG00000033111 (71%)

Antigen Sequence:
LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 설명
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.