Atlas Antibodies Anti-C2orf50 Antibody

상품 한눈에 보기

Human C2orf50 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 발현 분석에 적합. Affinity purified 형태로 높은 특이성과 재현성을 제공. Human 시료에 검증됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062894-100 Anti-C2orf50 Antibody, chromosome 2 open reading frame 50 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062894-25 Anti-C2orf50 Antibody, chromosome 2 open reading frame 50 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C2orf50 Antibody

Anti-C2orf50 Antibody

Target: chromosome 2 open reading frame 50 (C2orf50)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human C2orf50.

Alternative Gene Names

FLJ25143

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	chromosome 2 open reading frame 50
Target Gene	C2orf50
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MGSHPTPGLQRTTSAGYRLPPTRPPASVSPAARGGPMASRGLAGGCQAPQALKAQRV