
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C2orf49 Antibody
상품 한눈에 보기
Human C2orf49 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 affinity purification 되었으며, 높은 종간 서열 유사성을 보입니다. PBS/glycerol buffer에 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060814-100 Anti-C2orf49 Antibody, chromosome 2 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060814-25 Anti-C2orf49 Antibody, chromosome 2 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C2orf49 Antibody
Anti-C2orf49 Antibody
Target: chromosome 2 open reading frame 49 (C2orf49)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C2orf49.
Alternative Gene Names
- asw
- MGC5509
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016447 | 91% |
| Mouse | ENSMUSG00000010290 | 91% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02% (preservative) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



