CacheBy
Atlas Antibodies Anti-C2orf49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf49 Antibody

상품 한눈에 보기

Human C2orf49 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 및 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043846-100 Anti-C2orf49 Antibody, chromosome 2 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043846-25 Anti-C2orf49 Antibody, chromosome 2 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf49 Antibody

Anti-C2orf49 Antibody

Target: chromosome 2 open reading frame 49 (C2orf49)
Type: Polyclonal Antibody against Human C2orf49


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human C2orf49 protein.


Alternative Gene Names

  • asw
  • MGC5509

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 2 open reading frame 49
Target Gene C2orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
CTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREQHEIKNETKRSSTVDGLRKRPL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016447 (91%), Mouse ENSMUSG00000010290 (91%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.