CacheBy
Atlas Antibodies Anti-C2orf61 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf61 Antibody

상품 한눈에 보기

Human C2orf61 단백질을 인식하는 Rabbit Polyclonal IgG 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며 안정적인 PBS/glycerol buffer로 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052691-100 Anti-C2orf61 Antibody, chromosome 2 open reading frame 61 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052691-25 Anti-C2orf61 Antibody, chromosome 2 open reading frame 61 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf61 Antibody

Anti-C2orf61 Antibody

Target: Chromosome 2 open reading frame 61 (C2orf61)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C2orf61.

Alternative Gene Names

  • FLJ40172

Open Datasheet

Target Information

  • Target Protein: Chromosome 2 open reading frame 61
  • Target Gene: C2orf61
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000040136 68%
Mouse ENSMUSG00000036557 67%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.