Thermo Fisher Scientific HSPA9 Polyclonal Antibody
HSPA9 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, ICC, Flow Cytometry 등에 사용 가능. 인간, 마우스, 랫트, 비인간 영장류 반응성. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성 제공. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Grp75 (C-terminus, 646–679aa: KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746526 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The HSP70 family includes four conserved proteins: HSP70, HSC70, GRP75, and GRP78. GRP75 is localized in the mitochondrial matrix and assists in translocation and folding of nascent polypeptides from nuclear and mitochondrial origins. GRP75 and GRP78 are not responsive to heat stress but are induced by glucose deprivation.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HSP105 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSP60 Polyclonal Antibody
561,100원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPA9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPB8 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPB2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|