원본
Thermo Fisher Scientific HSPA9 Polyclonal Antibody
상품 한눈에 보기
HSPA9 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, ICC, Flow Cytometry 등에 사용 가능. 인간, 마우스, 랫트, 비인간 영장류 반응성. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성 제공. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오전 12:58
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579410 HSPA9 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific HSPA9 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human Grp75 (C-terminus, 646–679aa: KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746526 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The HSP70 family includes four conserved proteins: HSP70, HSC70, GRP75, and GRP78. GRP75 is localized in the mitochondrial matrix and assists in translocation and folding of nascent polypeptides from nuclear and mitochondrial origins. GRP75 and GRP78 are not responsive to heat stress but are induced by glucose deprivation.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific HSP105 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HSP60 Polyclonal Antibody561,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HSPB8 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific HSPB2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.