CacheBy
Atlas Antibodies Anti-PPM1G Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPM1G Antibody

상품 한눈에 보기

인간 PPM1G 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB에서 유전자 기반 검증 완료. 토끼에서 생산된 IgG 항체로 인간, 마우스, 랫트에 반응. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA035530-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035530-100 Anti-PPM1G Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1G 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035530-25 Anti-PPM1G Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1G 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPM1G Antibody

Anti-PPM1G Antibody

Protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression by comparison to RNA-seq data in high and low expression tissues.
  • WB (Western Blot): Genetic validation by siRNA knockdown.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PPM1G


Alternative Gene Names

PP2CG, PP2Cgamma


Target Information

항목 내용
Target Protein protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G
Target Gene PPM1G
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD

Verified Species Reactivity

Human, Mouse, Rat


Interspecies Information

Ortholog ID Antigen Sequence Identity
Rat ENSRNOG00000026905 97%
Mouse ENSMUSG00000029147 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Genetic Validation
Genetic Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.