
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPM1G Antibody
상품 한눈에 보기
인간 PPM1G 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB에서 유전자 기반 검증 완료. 토끼에서 생산된 IgG 항체로 인간, 마우스, 랫트에 반응. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA035530-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035530-100 Anti-PPM1G Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1G 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035530-25 Anti-PPM1G Antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1G 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPM1G Antibody
Anti-PPM1G Antibody
Protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot): Genetic validation by siRNA knockdown.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PPM1G
Alternative Gene Names
PP2CG, PP2Cgamma
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G |
| Target Gene | PPM1G |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000026905 | 97% |
| Mouse | ENSMUSG00000029147 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




