
Atlas Antibodies Anti-PPM1G Antibody
상품 한눈에 보기
인간 PPM1G 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB에서 유전자 기반 검증 완료. 토끼에서 생산된 IgG 항체로 인간, 마우스, 랫트에 반응. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPM1G Antibody
Protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot): Genetic validation by siRNA knockdown.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human PPM1G
Alternative Gene Names
PP2CG, PP2Cgamma
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase, Mg²⁺/Mn²⁺ dependent, 1G |
| Target Gene | PPM1G |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000026905 | 97% |
| Mouse | ENSMUSG00000029147 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPM1H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPM1G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPM1G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPM1F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPM1E Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.