
Atlas Antibodies Anti-PPIH Antibody
상품 한눈에 보기
Human PPIH 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보임. 40% 글리세롤 기반 버퍼에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPIH Antibody
Target: peptidylprolyl isomerase H (cyclophilin H)
Type: Polyclonal Antibody against Human PPIH
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human PPIH (peptidylprolyl isomerase H, cyclophilin H).
Alternative Gene Names
CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Peptidylprolyl isomerase H (Cyclophilin H) |
| Target Gene | PPIH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033036 (100%) Rat ENSRNOG00000008489 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
