Atlas Antibodies Anti-PPIH Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA059019-100 | - | Atlas Antibodies HPA059019-100 Anti-PPIH Antibody, peptidylprolyl isomerase H (cyclophilin H) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA059019-25 | - | Atlas Antibodies HPA059019-25 Anti-PPIH Antibody, peptidylprolyl isomerase H (cyclophilin H) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PPIH Antibody
peptidylprolyl isomerase H (cyclophilin H)
Recommended Applications
Product Description
Polyclonal Antibody against Human PPIH
Alternative Gene Names
CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Target Protein
peptidylprolyl isomerase H (cyclophilin H)
Target Gene
PPIH
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000033036 (100%)
Rat ENSRNOG00000008489 (100%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|