
Atlas Antibodies Anti-PPFIBP1 Antibody
Human PPFIBP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation을 통해 신뢰성 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. Glycerol/PBS buffer로 안정화 처리됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPFIBP1 Antibody
PTPRF interacting protein, binding protein 1 (liprin beta 1)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PPFIBP1
Alternative Gene Names
hSGT2, hSgt2p, L2, SGT2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PTPRF interacting protein, binding protein 1 (liprin beta 1) |
| Target Gene | PPFIBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000016487 (70%), Rat ENSRNOG00000031709 (67%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPFIBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPFIBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPFIBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPFIA4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPFIA4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|