CacheBy
Atlas Antibodies Anti-PPA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPA1 Antibody

상품 한눈에 보기

Human PPA1 단백질을 타겟으로 하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. 높은 종 간 보존성을 가진 항원 서열 기반. Affinity purification으로 높은 특이성과 재현성 제공. 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019878-100 Anti-PPA1 Antibody, pyrophosphatase (inorganic) 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019878-25 Anti-PPA1 Antibody, pyrophosphatase (inorganic) 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPA1 Antibody

Anti-PPA1 Antibody

Target: pyrophosphatase (inorganic) 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PPA1


Alternative Gene Names

IOPPP, PP, PP1, Ppase, SID6-8061

Open Datasheet


Target Information

항목 내용
Target Protein pyrophosphatase (inorganic) 1
Target Gene PPA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000020089 (95%), Rat ENSRNOG00000000557 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.