
Atlas Antibodies Anti-POLR2C Antibody
인간 POLR2C 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 비교로 검증된 신뢰성 높은 제품. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR2C Antibody
polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC
Product Description
Polyclonal Antibody against Human POLR2C
Alternative Gene Names
RPB3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) II (DNA directed) polypeptide C, 33kDa |
| Target Gene | POLR2C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000031783 (100%) Rat ENSRNOG00000015720 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR2E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR2A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|