AI 생성

1 / 2

Atlas Antibodies Anti-POLR2C Antibody

상품 한눈에 보기

인간 POLR2C 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 독립 항체 비교로 검증된 신뢰성 높은 제품. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040919-100 Anti-POLR2C Antibody, polymerase (RNA) II (DNA directed) polypeptide C, 33kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040919-25 Anti-POLR2C Antibody, polymerase (RNA) II (DNA directed) polypeptide C, 33kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

polymerase (RNA) II (DNA directed) polypeptide C, 33kDa

IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC

Polyclonal Antibody against Human POLR2C

RPB3

항목	내용
Target Protein	polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
Target Gene	POLR2C
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000031783 (100%) Rat ENSRNOG00000015720 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.